PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN13461.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 206aa    MW: 23219.4 Da    PI: 10.4231
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN13461.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.5e-1370114347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + +  G+g+W+ I+r + k+Rt+ q+ s+ qky
       KHN13461.1  70 PWTEEEHRLFLLGLQNIGKGDWRGISRNFVKTRTPTQVASHAQKY 114
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.96463119IPR017930Myb domain
SuperFamilySSF466896.13E-1765118IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-1766117IPR006447Myb domain, plants
SMARTSM007175.8E-967117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-1169114IPR009057Homeodomain-like
CDDcd001671.56E-870115No hitNo description
PfamPF002491.2E-1070114IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MCSAEKDGIM LFGVRLSVVD NHPTSFRKSA SMTNLSQYES PPPHDPNAGY ASDDVVHPSR  60
HTRERKRGVP WTEEEHRLFL LGLQNIGKGD WRGISRNFVK TRTPTQVASH AQKYFLRRHT  120
QNRRRRRSSL FDITTDSVME PWPEKEEEQV VLPSARSKPV LPVPPSSKMA ELDLSGKSLS  180
LKLPVSKPPI SKENFGGIPL SVLLEG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0919340.0BT091934.1 Soybean clone JCVI-FLGm-9M5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236463.11e-150MYB transcription factor MYB149
SwissprotQ2V9B04e-46MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A0B2PVU31e-151A0A0B2PVU3_GLYSO; Transcription factor MYB1R1
STRINGGLYMA08G40460.11e-150(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-57MYB_related family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]